PDB entry 1u8x

View 1u8x on RCSB PDB site
Description: crystal structure of glva from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, PSI, protein structure initiative, MCSG, GLUCOSIDASE, NAD-DEPENDENT, Midwest Center for Structural Genomics, HYDROLASE
Deposited on 2004-08-09, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Maltose-6'-phosphate glucosidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glvA, glvG, glv-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54716
      • modified residue (46)
      • modified residue (106)
      • modified residue (116)
      • modified residue (144)
      • modified residue (157)
      • modified residue (166)
      • modified residue (195)
      • modified residue (203)
      • modified residue (215)
      • modified residue (240)
      • modified residue (297)
      • modified residue (312)
      • modified residue (325)
      • modified residue (361)
      • modified residue (379)
      • modified residue (407)
    Domains in SCOPe 2.07: d1u8xx1, d1u8xx2
  • Heterogens: G6P, MN, NAD, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1u8xX (X:)
    mhhhhhhssgvdlgtenlyfqsnmkkksfsiviagggstftpgivlmlldhleefpirkl
    klydndkerqdriagacdvfirekapdiefaattdpeeaftdvdfvmahirvgkyamral
    deqiplkygvvgqetcgpggiaygmrsiggvleildymekyspdawmlnysnpaaivaea
    trrlrpnskilnicdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndl
    mpklkehvsqygyipkteaeaveaswndtfakardvqaadpdtlpntylqyylfpddmvk
    ksnpnhtranevmegreafifsqcdmitreqssenseikiddhasyivdlaraiayntge
    rmllivenngaianfdptamvevpcivgsngpepitvgtipqfqkglmeqqvsvekltve
    awaeksfqklwqalilsktvpnarvarliledlveankdfwpeldqsptris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8xX (X:)
    kksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfireka
    pdiefaattdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygm
    rsiggvleildymekyspdawmlnysnpaaivaeatrrlrpnskilnicdmpvgiedrma
    qilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqygyipktswndtfak
    ardvqaadpdtlpntylqyylfpddmvkksnpnhtranevmegreafifsqcdmitreqs
    senseikiddhasyivdlaraiayntgermllivenngaianfdptamvevpcivgsngp
    epitvgtipqfqkglmeqqvsvekltveawaeksfqklwqalilsktvpnarvarliled
    lveankdfwpeldqsp