PDB entry 1u8w

View 1u8w on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana nucleoside diphosphate kinase 1
Class: transferase
Keywords: nucleotide diphosphate, kinase,, TRANSFERASE
Deposited on 2004-08-07, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8wa_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8wb_
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8wc_
  • Chain 'D':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8wd_
  • Chain 'E':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8we_
  • Chain 'F':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8wf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8wA (A:)
    meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
    lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
    esarkeialwfpdgpvnwqssvhpwvyet
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8wB (B:)
    meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
    lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
    esarkeialwfpdgpvnwqssvhpwvyet
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8wC (C:)
    meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
    lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
    esarkeialwfpdgpvnwqssvhpwvyet
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8wD (D:)
    meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
    lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
    esarkeialwfpdgpvnwqssvhpwvyet
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8wE (E:)
    meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
    lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
    esarkeialwfpdgpvnwqssvhpwvyet
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8wF (F:)
    meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
    lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
    esarkeialwfpdgpvnwqssvhpwvyet