PDB entry 1u8u

View 1u8u on RCSB PDB site
Description: E. coli Thioesterase I/Protease I/Lysophospholiase L1 in complexed with octanoic acid
Class: hydrolase
Keywords: Hydrolase, Protease
Deposited on 2004-08-07, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.228
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA Thioesterase I
    Species: Escherichia coli [TaxId:562]
    Gene: tesA, apeA, pldC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8ua_
  • Heterogens: SO4, OCA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8uA (A:)
    adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh
    dslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8uA (A:)
    adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvh