PDB entry 1u8t

View 1u8t on RCSB PDB site
Description: crystal structure of chey d13k y106w alone and in complex with a flim peptide
Deposited on 2004-08-06, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u8ta_
  • Chain 'B':
    Domains in SCOP 1.71: d1u8tb_
  • Chain 'C':
    Domains in SCOP 1.71: d1u8tc_
  • Chain 'D':
    Domains in SCOP 1.71: d1u8td_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8tA (A:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8tA (A:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifekm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8tB (B:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8tC (C:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8tD (D:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm