PDB entry 1u8s

View 1u8s on RCSB PDB site
Description: Crystal structure of putative glycine cleavage system transcriptional repressor
Deposited on 2004-08-06, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8sA (A:)
    msltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnit
    rvettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqig
    maslsaqtiskdklhseqnqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn
    sqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8sA (A:)
    sltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnitr
    vettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqigm
    aslsaqtisnqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u8sB (B:)
    msltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnit
    rvettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqig
    maslsaqtiskdklhseqnqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn
    sqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8sB (B:)
    sltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnitr
    vettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqigm
    aslsaqtisknqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn