PDB entry 1u8s

View 1u8s on RCSB PDB site
Description: Crystal structure of putative glycine cleavage system transcriptional repressor
Class: transcription
Keywords: Structural Genomics, Protein Structure Initiative (PSI), Domain Swapping, ACT Domain, Glycine Cleavage System, transcription
Deposited on 2004-08-06, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine cleavage system transcriptional repressor, putative
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQ45 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1u8sa1, d1u8sa2, d1u8sa3
  • Chain 'B':
    Compound: glycine cleavage system transcriptional repressor, putative
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQ45 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1u8sb1, d1u8sb2, d1u8sb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8sA (A:)
    msltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnit
    rvettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqig
    maslsaqtiskdklhseqnqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn
    sqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8sA (A:)
    sltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnitr
    vettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqigm
    aslsaqtisnqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u8sB (B:)
    msltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnit
    rvettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqig
    maslsaqtiskdklhseqnqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn
    sqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8sB (B:)
    sltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnitr
    vettlpllgqqhdlitmmkrtsphdhqthaytvevyvesddklgltekftqffaqrqigm
    aslsaqtisknqfhiaisarvdsgcnlmqlqeefdalctaldvqgslnfikn