PDB entry 1u8p

View 1u8p on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ECDKWCS
Deposited on 2004-08-06, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 3.23 Å
R-factor: 0.212
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8pA (A:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyecevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u8pB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstagaaaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8pB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapgaaaalgclvkdyfpepvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslqtytcnvnhkpsntkvdkrvepksc