PDB entry 1u8k

View 1u8k on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide LELDKWASL
Class: immune system
Keywords: Fab complex, HIV-1 Neutralization, gp41 Peptide
Deposited on 2004-08-06, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.215
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody 2f5 (light chain)
    Species: HOMO SAPIENS
    Gene:
    Domains in SCOP 1.75: d1u8ka1, d1u8ka2
  • Chain 'B':
    Compound: antibody 2f5 (heavy chain)
    Species: HOMO SAPIENS
    Gene:
    Domains in SCOP 1.75: d1u8kb1, d1u8kb2
  • Chain 'C':
    Compound: gp41 peptide
    Species: synthetic, synthetic
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8kA (A:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdrqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyecevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u8kB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapcskstaggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8kB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapcstaalgclvkdyfpepvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepks
    

  • Chain 'C':
    No sequence available.