PDB entry 1u8f

View 1u8f on RCSB PDB site
Description: Crystal Structure Of Human Placental Glyceraldehyde-3-Phosphate Dehydrogenase At 1.75 Resolution
Class: oxidoreductase
Keywords: gapdh, rossmann fold, oxidoreductase, dehydrogenase, mammalian gapdh, gapd
Deposited on 2004-08-05, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8fo1, d1u8fo2
  • Chain 'P':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8fp1, d1u8fp2
  • Chain 'Q':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8fq1, d1u8fq2
  • Chain 'R':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u8fr1, d1u8fr2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1u8fO (O:)
    mgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtv
    kaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrvi
    isapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvha
    itatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanv
    svvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagag
    ialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8fO (O:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1u8fP (P:)
    mgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtv
    kaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrvi
    isapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvha
    itatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanv
    svvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagag
    ialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8fP (P:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1u8fQ (Q:)
    mgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtv
    kaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrvi
    isapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvha
    itatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanv
    svvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagag
    ialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8fQ (Q:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1u8fR (R:)
    mgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtv
    kaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrvi
    isapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvha
    itatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanv
    svvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagag
    ialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8fR (R:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske