PDB entry 1u8e

View 1u8e on RCSB PDB site
Description: human dipeptidyl peptidase IV/cd26 mutant y547f
Class: hydrolase
Keywords: alpha/beta hydrolase, beta-propeller, homodimer, hydrolase
Deposited on 2004-08-05, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (0-End)
      • engineered (508)
    Domains in SCOPe 2.07: d1u8ea1, d1u8ea2
  • Chain 'B':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (0-727)
      • engineered (508)
    Domains in SCOPe 2.07: d1u8eb1, d1u8eb2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8eA (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvfagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8eA (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvfagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8eB (B:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvfagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp