PDB entry 1u8b

View 1u8b on RCSB PDB site
Description: Crystal structure of the methylated N-ADA/DNA complex
Deposited on 2004-08-05, released 2005-10-11
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.235
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ada polyprotein
    Species: Escherichia coli [TaxId:562]
    Gene: ADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06134 (2-End)
      • cloning artifact (0-1)
      • conflict (68)
      • conflict (72-73)
  • Chain 'B':
    Compound: 5'-d(*tp*ap*ap*ap*tp*t)-3'
  • Chain 'C':
    Compound: 5'-d(p*ap*ap*tp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(p*ap*ap*ap*gp*cp*gp*cp*ap*ap*gp*ap*t)-3'
  • Chain 'E':
    Compound: 5'-d(*ap*ap*tp*cp*tp*tp*gp*cp*gp*cp*tp*tp*t)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1u8bA (A:)
    mkddqrwqsvlardpnadgefvfavrttgifcrpscrarhalrenvsfyanasealaagf
    rpckrcqpdkanprqhrldkithacrlleqetpvtlealadqvamspfhlhrlfkattgm
    tpkawqqawrarr
    

    Sequence, based on observed residues (ATOM records):
    >1u8bA (A:)
    mkddqrwqsvlardpnadgefvfavrttgifcrpscrarhalrenvsfyanasealaagf
    rpckrcqpdkanprqhrldkithacrlleqetpvtlealadqvamspfhlhrlfkattgm
    tpkawqqawrar
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.