PDB entry 1u89

View 1u89 on RCSB PDB site
Description: Solution structure of VBS2 fragment of talin
Class: structural protein
Keywords: 4-helix bundle, left-handed, STRUCTURAL PROTEIN
Deposited on 2004-08-05, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Talin 1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26039 (4-138)
    • cloning artifact (0-3)
  Domains in SCOPe 2.07: d1u89a1, d1u89a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u89A (A:)
  gshmqaatedgqllrgvgaaatavtqalnellqhvkahatgagpagrydqatdtiltvte
  nifssmgdagemvrqarilaqatsdlvnaikadaegesdlensrkllsaakiladatakm
  veaakgaaahpdseeqqqr