PDB entry 1u88

View 1u88 on RCSB PDB site
Description: Crystal Structure Of The 26 Kda Glutathione S-Transferase Y7F mutant From Schistosoma Japonicum Complexed With S-Octyl Glutathione
Class: transferase
Keywords: transferase
Deposited on 2004-08-05, released 2005-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.22
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-Transferase 26 kDa
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08515 (0-End)
      • engineered (6)
    Domains in SCOPe 2.06: d1u88a1, d1u88a2
  • Chain 'B':
    Compound: Glutathione S-Transferase 26 kDa
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08515 (0-End)
      • engineered (6)
    Domains in SCOPe 2.06: d1u88b1, d1u88b2
  • Heterogens: GTY

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u88A (A:)
    mspilgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u88A (A:)
    mspilgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u88B (B:)
    mspilgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u88B (B:)
    mspilgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqat