PDB entry 1u84

View 1u84 on RCSB PDB site
Description: Crystal Structure of APC36109 from Bacillus stearothermophilus
Deposited on 2004-08-04, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u84a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1u84A (A:)
snamdgqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyef
afdepipfphclklarrllelkqaascplp

    Sequence, based on observed residues (ATOM records): (download) 
    >1u84A (A:)
gqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyefafdep
ipfphclklarrllelkqaas