PDB entry 1u84

View 1u84 on RCSB PDB site
Description: Crystal Structure of APC36109 from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Hypothetical Protein, Bacillus stearothermophilus, protein structure initiative, MCSG, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-08-04, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • PDB 1U84
  Domains in SCOPe 2.08: d1u84a_
• Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1u84A (A:)
  snamdgqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyef
  afdepipfphclklarrllelkqaascplp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1u84A (A:)
  gqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyefafdep
  ipfphclklarrllelkqaas