PDB entry 1u83

View 1u83 on RCSB PDB site
Description: PSL synthase from Bacillus subtilis
Class: lyase
Keywords: Bacillus subtilis, structural genomics, Phosphosulfolactate synthase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, LYASE
Deposited on 2004-08-04, released 2004-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphosulfolactate synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ComA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06739
      • modified residue (135)
      • modified residue (181)
    Domains in SCOPe 2.08: d1u83a_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u83A (A:)
    mgsshhhhhhssgrenlyfqghmndfslelpvrtnkpretgqsilidngyplqffkdaia
    gasdyidfvkfgwgtslltkdleekistlkehditfffggtlfekyvsqkkvnefhryct
    yfgceyieisngtlpmtnkekaayiadfsdeflvlsevgskdaelasrqsseewleyive
    dmeagaekvitearesgtggicsssgdvrfqivddiissdidinrlifeapnktlqqgfi
    qkigpnvnlanipfhdaialetlrlglrsdtfflgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u83A (A:)
    dfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdlee
    kistlkehditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaay
    iadfsdeflvlsevgskdqsseewleyivedmeagaekviteqivddiissdidinrlif
    eapnktlqqgfiqkigpnvnlanipfhdaialetlrlglrsdtff