PDB entry 1u81

View 1u81 on RCSB PDB site
Description: Delta-17 Human ADP Ribosylation Factor 1 Complexed with GDP
Class: protein transport
Keywords: Delta17Arf1, D17Arf1, Arf1, GDP-Binding, Membrane Trafficking, RDC Refinement, PROTEIN TRANSPORT
Deposited on 2004-08-04, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u81a_
  • Heterogens: MG, GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u81A (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk