PDB entry 1u7x

View 1u7x on RCSB PDB site
Description: crystal structure of a mutant M. jannashii tyrosyl-tRNA synthetase specific for O-methyl-tyrosine
Class: ligase
Keywords: Rossmann fold, LIGASE
Deposited on 2004-08-04, released 2005-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered (31)
      • engineered (106)
      • engineered (157)
      • engineered (161)
    Domains in SCOPe 2.08: d1u7xa_
  • Chain 'B':
    Compound: Tyrosyl-tRNA synthetase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered (31)
      • engineered (106)
      • engineered (157)
      • engineered (161)
    Domains in SCOPe 2.08: d1u7xb_
  • Heterogens: K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7xA (A:)
    mdefemikrntseiiseeelrevlkkdeksaqigfepsgkihlghylqikkmidlqnagf
    diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygstfqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnaihypgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7xA (A:)
    mdefemikrntseiiseeelrevlkkdeksaqigfepsgkihlghylqikkmidlqnagf
    diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygstfqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnaihypgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u7xB (B:)
    mdefemikrntseiiseeelrevlkkdeksaqigfepsgkihlghylqikkmidlqnagf
    diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygstfqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnaihypgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7xB (B:)
    mdefemikrntseiiseeelrevlkkdeksaqigfepsgkihlghylqikkmidlqnagf
    diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygstfqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnaihypgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrl