PDB entry 1u7w

View 1u7w on RCSB PDB site
Description: Phosphopantothenoylcysteine synthetase from E. coli, CTP-complex
Class: ligase
Keywords: Coenzyme A biosynthesis, LIGASE
Deposited on 2004-08-04, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme A biosynthesis bifunctional protein coaBC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ0
      • engineered (29)
    Domains in SCOPe 2.07: d1u7wa_
  • Chain 'B':
    Compound: Coenzyme A biosynthesis bifunctional protein coaBC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ0 (0-225)
      • engineered (29)
    Domains in SCOPe 2.07: d1u7wb_
  • Chain 'C':
    Compound: Coenzyme A biosynthesis bifunctional protein coaBC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ0 (0-End)
      • engineered (29)
    Domains in SCOPe 2.07: d1u7wc_
  • Heterogens: CA, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7wA (A:)
    spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
    ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdel
    tikmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptq
    gfnsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7wA (A:)
    vndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvslpt
    ppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekdeltikmvknpdi
    vagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvlhlfwqdgdkvlple
    rkellgqllldeivtrydeknr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u7wB (B:)
    spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
    ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdel
    tikmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptq
    gfnsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7wB (B:)
    spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
    ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekeltikmvknpd
    ivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicanalhlfwqdgdkvlple
    rkellgqllldeivtrydeknrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u7wC (C:)
    spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
    ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdel
    tikmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptq
    gfnsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7wC (C:)
    spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
    ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapedeltikmvknpd
    ivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandnalhlfwqdgdkvlp
    lerkellgqllldeivtrydeknr