PDB entry 1u7u

View 1u7u on RCSB PDB site
Description: Phosphopantothenoylcysteine synthetase from E. coli
Class: ligase
Keywords: Coenzyme A biosynthesis, LIGASE
Deposited on 2004-08-04, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme A biosynthesis bifunctional protein coaBC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ0
      • engineered (29)
    Domains in SCOPe 2.08: d1u7ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7uA (A:)
    spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
    ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdel
    tikmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptq
    gfnsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7uA (A:)
    pvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvslp
    tppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraaltikmvknpdivagvaal
    kdhrpyvvgfaaetnnveeyarqkrirknldlicansdnnalhlfwqdgdkvlplerkel
    lgqllldeivtrydeknr