PDB entry 1u7t

View 1u7t on RCSB PDB site
Description: Crystal Structure of ABAD/HSD10 with a Bound Inhibitor
Class: oxidoreductase
Keywords: PROTEIN-INHIBITOR COMPLEX, ROSSMANN FOLD, oxidoreductase
Deposited on 2004-08-04, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-CoA dehydrogenase type II
    Species: Homo sapiens [TaxId:9606]
    Gene: HADH2, ERAB, XH98G2, SCHAD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99714 (Start-260)
      • engineered (213)
    Domains in SCOPe 2.07: d1u7ta_
  • Chain 'B':
    Compound: 3-hydroxyacyl-CoA dehydrogenase type II
    Species: Homo sapiens [TaxId:9606]
    Gene: HADH2, ERAB, XH98G2, SCHAD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99714 (Start-260)
      • engineered (213)
    Domains in SCOPe 2.07: d1u7tb_
  • Chain 'C':
    Compound: 3-hydroxyacyl-CoA dehydrogenase type II
    Species: Homo sapiens [TaxId:9606]
    Gene: HADH2, ERAB, XH98G2, SCHAD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99714 (Start-260)
      • engineered (213)
    Domains in SCOPe 2.07: d1u7tc_
  • Chain 'D':
    Compound: 3-hydroxyacyl-CoA dehydrogenase type II
    Species: Homo sapiens [TaxId:9606]
    Gene: HADH2, ERAB, XH98G2, SCHAD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99714 (Start-260)
      • engineered (213)
    Domains in SCOPe 2.07: d1u7td_
  • Heterogens: TDT, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7tA (A:)
    maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
    apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
    nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqai
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7tA (A:)
    svkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadvt
    sekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgtf
    nvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqaiienpfl
    ngevirldgairmqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u7tB (B:)
    maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
    apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
    nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqai
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7tB (B:)
    svkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadvt
    sekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgtf
    nvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqaiienpfl
    ngevirldgairmqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u7tC (C:)
    maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
    apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
    nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqai
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7tC (C:)
    svkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadvt
    sekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgtf
    nvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqaiienpfl
    ngevirldgairmqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u7tD (D:)
    maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
    apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
    nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqai
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7tD (D:)
    svkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadvt
    sekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgtf
    nvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqaiienpfl
    ngevirldgairmqp