PDB entry 1u7s

View 1u7s on RCSB PDB site
Description: Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form 1)
Class: transport protein
Keywords: Sperm Whale myoglobin Low ionic strength
Deposited on 2004-08-04, released 2005-07-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.153
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u7sa1
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u7sA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg