PDB entry 1u7r

View 1u7r on RCSB PDB site
Description: Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form2 )
Class: transport protein
Keywords: Sperm Whale myoglobin, Low ionic strength, TRANSPORT PROTEIN
Deposited on 2004-08-04, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.138
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOPe 2.07: d1u7ra_
• Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u7rA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg