PDB entry 1u7q

View 1u7q on RCSB PDB site
Description: the solution structure of the nucleotide binding domain of kdpb
Class: hydrolase
Keywords: alpha-beta sandwich, hydrolase
Deposited on 2004-08-04, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium-transporting ATPase B chain
    Species: Escherichia coli [TaxId:562]
    Gene: kdpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u7qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7qA (A:)
    mghhhhhhhhhhssghggrhnrqasefipaqgvdektladaaqlasladetpegrsivil
    akqrfnlrerdvqslhatfvpftaqsrmsginidnrmirkgsvdairrhveangghfptd
    vdqkvdqvarqgatplvvvegsrvlgvialkdivkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7qA (A:)
    nrqasefipaqgvdektladaaqlasladetpegrsivilakqrfnlrerdvqslhatfv
    pftaqsrmsginidnrmirkgsvdairrhveangghfptdvdqkvdqvarqgatplvvve
    gsrvlgvialkdivkg