PDB entry 1u7o

View 1u7o on RCSB PDB site
Description: Magnesium Dependent Phosphatase 1 (MDP-1)
Class: hydrolase
Keywords: HAD superfamily, phosphoryl transfer, phosphotyrosine phosphatase, aspartate nucleophile, enzyme evolution, structural enzymology, class III, HYDROLASE
Deposited on 2004-08-04, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: magnesium-dependent phosphatase-1
    Species: Mus musculus [TaxId:10090]
    Gene: AF230273
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u7oa_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7oA (A:)
    mtrlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqniqlypevpevlgrlqs
    lgvpvaaasrtseiqganqllelfdlgkyfiqreiypgskvthferlhhktgvpfsqmvf
    fddenrniidvgrlgvtcihirdgmslqtltqgletfakaqagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7oA (A:)
    mtrlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqniqlypevpevlgrlqs
    lgvpvaaasrtseiqganqllelfdlgkyfiqreiypgskvthferlhhktgvpfsqmvf
    fddenrniidvgrlgvtcihirdgmslqtltqgletfakaqag