PDB entry 1u7l

View 1u7l on RCSB PDB site
Description: Crystal Structure of subunit C (vma5p) of the yeast V-ATPase
Class: structural protein
Keywords: Hydrolase, STRUCTURAL PROTEIN
Deposited on 2004-08-04, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.211
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar ATP synthase subunit C
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VMA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u7la_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7lA (A:)
    matalytandfilislpqnaqpvtapgsktdswfnetliggrafvsdfkipefkigsldt
    liveseelskvdnqigasigkiieilqglnetstnayrtlpinnmpvpeylenfqwqtrk
    fkldksikdlitlisnessqldadvratyanynsaktnlaaaerkktgdlsvrslhdivk
    pedfvlnsehlttvlvavpkslksdfeksyetlsknvvpasasviaedaeyvlfnvhlfk
    knvqefttaarekkfiprefnyseelidqlkkehdsaasleqslrvqlvrlaktayvdvf
    inwfhikalrvyvesvlryglpphfnikiiavppknlskckselidafgflggnafmkdk
    kgkinkqdtslhqyaslvdteyepfvmyiinl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7lA (A:)
    lytandfilislpqnaqpvtapgsktdswfnetliggrafvsdfkipefkigsldtlive
    seelskvdnqigasigkiieilqglnetstnayrtlpinnmpvpeylenfqwqtrkfkld
    ksikdlitlisnessqldadvratyanynsaktnlaaaerkktgdlsvrslhdivkpedf
    vlnsehlttvlvavpkslksdfeksyetlsknvvpasasviaedaeyvlfnvhlfkknvq
    efttaarekkfiprefnyseelidqlkkehdsaasleqslrvqlvrlaktayvdvfinwf
    hikalrvyvesvlryglpphfnikiiavppknlskckselidafgflggnafmyepfvmy
    iinl