PDB entry 1u7j

View 1u7j on RCSB PDB site
Description: Solution structure of a diiron protein model
Class: de novo protein
Keywords: Diiron proteins, four-helix bundle, protein design, inter-helical loops, DE NOVO PROTEIN
Deposited on 2004-08-04, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Four-helix bundle model
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U7J (0-48)
    Domains in SCOPe 2.07: d1u7ja1
  • Chain 'B':
    Compound: Four-helix bundle model
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U7J (0-48)
    Domains in SCOPe 2.07: d1u7jb1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u7jA (A:)
    mdylrelykleqqamklyreaservgdpvlakiledeekhiewleting
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u7jB (B:)
    mdylrelykleqqamklyreaservgdpvlakiledeekhiewleting