PDB entry 1u7f

View 1u7f on RCSB PDB site
Description: Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex
Class: signaling protein
Keywords: Smad, TGF-beta, signal transduction, protein complex, phosphorylation, signaling protein
Deposited on 2004-08-03, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mothers against decapentaplegic homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SMAD3, MADH3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84022 (0-197)
      • modified residue (195)
      • modified residue (197)
    Domains in SCOPe 2.07: d1u7fa_
  • Chain 'B':
    Compound: Mothers against decapentaplegic homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: SMAD4, MADH4, DPC4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u7fb_
  • Chain 'C':
    Compound: Mothers against decapentaplegic homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SMAD3, MADH3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84022 (Start-197)
      • modified residue (195)
      • modified residue (197)
    Domains in SCOPe 2.07: d1u7fc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u7fA (A:)
    epafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltr
    rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe
    faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl
    dkvltqmgspsircssvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u7fB (B:)
    isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
    eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
    yikvfdlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvd
    dlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7fB (B:)
    isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
    eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldredavhkiypsayikvfd
    lrqchrqmqqqaataqigvddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhral
    qlldevlhtmpia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u7fC (C:)
    epafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltr
    rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe
    faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl
    dkvltqmgspsircssvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7fC (C:)
    afwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltrrh
    igrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqefa
    allaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwldk
    vltqmgspsircssvs