PDB entry 1u7e

View 1u7e on RCSB PDB site
Description: The crystal structure of a Protein Kinase A complex
Class: transferase
Keywords: cAMP, cAMP dependent protein kinase, Protein-Protein complx, AMP-PNP, PK Regulation, transferase
Deposited on 2004-08-03, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Mus musculus [TaxId:10090]
    Gene: Prkaca, Pkaca
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05132 (Start-349)
      • modified residue (196)
      • engineered (198)
      • modified residue (337)
    Domains in SCOPe 2.07: d1u7ea_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory chain
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7eA (A:)
    gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
    khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlagtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7eA (A:)
    eqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhya
    mkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfs
    hlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakr
    vkgrtwtlagtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyeki
    vsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkv
    eapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

  • Chain 'B':
    No sequence available.