PDB entry 1u7d

View 1u7d on RCSB PDB site
Description: crystal structure of apo M. jannashii tyrosyl-tRNA synthetase
Class: ligase
Keywords: Rossmann fold, LIGASE
Deposited on 2004-08-03, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u7da_
  • Chain 'B':
    Compound: Tyrosyl-tRNA synthetase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u7db_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7dA (A:)
    mdefemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagf
    diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvndihylgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7dA (A:)
    mdefemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagf
    diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsenpkvaeviypimqvndihylgvdvavggmeqrkihmlarellpkkv
    vcihnpvltgldgekgnfiavddspeeirakikkaycpagvvegnpimeiakyfleyplt
    ikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u7dB (B:)
    mdefemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagf
    diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvndihylgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7dB (B:)
    defemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagfd
    iiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrl
    alkttlkrarpkvaeviypimqvndihylgvdvavggmeihmlarellpkkvvcihnpvl
    tgldgeggnfiavddspeeirakikkaycpagvvegnpimeiakyfleypltikrpekfg
    gdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrl