PDB entry 1u7b

View 1u7b on RCSB PDB site
Description: Crystal structure of hPCNA bound to residues 331-350 of the flap endonuclease-1 (FEN1)
Class: replication
Keywords: flap endonuclease, sliding clamp, DNA processing, FEN1, PIP-Box, REPLICATION
Deposited on 2004-08-03, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.217
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: PCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u7ba1, d1u7ba2
  • Chain 'B':
    Compound: SRQGSTQGRLDDFFKVTGSL peptide of Flap endonuclease-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7bA (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7bA (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtseeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadm
    ghlkyylapki
    

  • Chain 'B':
    No sequence available.