PDB entry 1u77

View 1u77 on RCSB PDB site
Description: Crystal Structure of Ammonia Channel AmtB from E. Coli
Class: transport protein
Keywords: Right handed helical bundle, transmembrane helices, membrane channel, ammonia channel, TRANSPORT PROTEIN
Deposited on 2004-08-02, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ammonium transporter
    Species: Escherichia coli [TaxId:562]
    Gene: amtB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69681 (Start-384)
      • modified residue (12-13)
      • modified residue (22)
      • modified residue (43)
      • engineered (67)
      • modified residue (81)
      • modified residue (91)
      • engineered (125)
      • modified residue (145)
      • modified residue (199)
      • engineered (254)
      • modified residue (300)
      • modified residue (327)
      • modified residue (347)
    Domains in SCOPe 2.07: d1u77a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u77A (A:)
    apavadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwv
    vygyslasgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgala
    erirfpavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgay
    ligkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataa
    ailgwifgewalrglpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvt
    mlkrllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesia
    itivwsgvvafigykladltvglrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u77A (A:)
    avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
    gyslasgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
    irfpavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
    gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
    lgwifgewalrglpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
    krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
    ivwsgvvafigykladltvglrv