PDB entry 1u76

View 1u76 on RCSB PDB site
Description: Crystal structure of hPCNA bound to residues 452-466 of the DNA polymerase-delta-p66 subunit
Deposited on 2004-08-02, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u76A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u76A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtseeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadm
    ghlkyylapkied
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u76C (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u76C (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnekvsdyemklmdl
    dveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngnik
    lsqteeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
    lkyylapkied
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u76E (E:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u76E (E:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtseavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
    lkyylapkiedee