PDB entry 1u76

View 1u76 on RCSB PDB site
Description: Crystal structure of hPCNA bound to residues 452-466 of the DNA polymerase-delta-p66 subunit
Class: replication
Keywords: DNA replication, sliding clamp, DNA polymerase delta, p66, PIP-Box
Deposited on 2004-08-02, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: PCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u76a1, d1u76a2
  • Chain 'B':
    Compound: KANRQVSITGFFQRK peptide from DNA polymerase delta subunit 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: PCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u76c1, d1u76c2
  • Chain 'D':
    Compound: KANRQVSITGFFQRK peptide from DNA polymerase delta subunit 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: PCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u76e1, d1u76e2
  • Chain 'F':
    Compound: KANRQVSITGFFQRK peptide from DNA polymerase delta subunit 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u76A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u76A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtseeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadm
    ghlkyylapkied
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u76C (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u76C (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnekvsdyemklmdl
    dveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngnik
    lsqteeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
    lkyylapkied
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u76E (E:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u76E (E:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtseavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
    lkyylapkiedee
    

  • Chain 'F':
    No sequence available.