PDB entry 1u73

View 1u73 on RCSB PDB site
Description: Crystal structure of a Dimeric Acidic Platelet Aggregation Inhibitor and Hypotensive Phospholipase A2 from Bothrops jararacussu
Class: hydrolase
Keywords: X-ray crystallography, acidic phospholipase A2, Bothrops jararacussu venom, platelet aggregation and hypotensive effects, crystal structure, oligomeric state, dimeric, hydrolase
Deposited on 2004-08-02, released 2004-10-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypotensive phospholipase A2
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8AXY1 (0-121)
  Domains in SCOPe 2.05: d1u73a_
• Chain 'B':
  Compound: hypotensive phospholipase A2
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8AXY1 (0-121)
  Domains in SCOPe 2.05: d1u73b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u73A (A:)
  slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
  idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
  pc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u73B (B:)
  slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
  idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
  pc