PDB entry 1u70

View 1u70 on RCSB PDB site
Description: Understanding the Role of Leu22 Variants in Methotrexate Resistance: Comparison of Wild-type and Leu22Arg Variant Mouse and Human Dihydrofolate Reductase
Class: oxidoreductase
Keywords: variant DHFR mouse, human, OXIDOREDUCTASE
Deposited on 2004-08-02, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mus musculus [TaxId:10090]
    Gene: Dhfr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00375 (0-185)
      • engineered (21)
    Domains in SCOPe 2.08: d1u70a_
  • Heterogens: MTX, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u70A (A:)
    vrplncivavsqnmgigkngdrpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
    peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
    yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
    vyekkd