PDB entry 1u6t

View 1u6t on RCSB PDB site
Description: Crystal structure of the human SH3 binding glutamic-rich protein like
Class: protein binding, signaling protein
Keywords: SH3-binding, GLUTAREDOXIN, THIOREDOXIN FOLD, X-RAY STRUCTURE, CRYSTALLOGRAPHY, PROTEIN BINDING, SIGNALING PROTEIN
Deposited on 2004-08-01, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-03-25, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 domain-binding glutamic acid-rich-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75368 (0-112)
      • expression tag (113-120)
    Domains in SCOPe 2.07: d1u6ta1, d1u6ta2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u6tA (A:)
    virvyiasssgstaikkkqqdvlgfleankigfeekdiaaneenrkwmrenvpensrpat
    gyplppqifnesqyrgdydaffearennavyaflgltappgskeaevqakqqalehhhhh
    h