PDB entry 1u6q

View 1u6q on RCSB PDB site
Description: Substituted 2-Naphthamadine inhibitors of Urokinase
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-07-30, released 2004-10-19
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.27
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: HOMO SAPIENS
    Gene: PLAU
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1u6qa_
  • Heterogens: 745

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u6qA (A:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irsht