PDB entry 1u6p

View 1u6p on RCSB PDB site
Description: NMR Structure of the MLV encapsidation signal bound to the Nucleocapsid protein
Class: Viral protein/RNA
Keywords: MLV, A-MINOR K-TURN, STEM LOOP, BULGE, G-U MISMATCH, G-A MISMATCH, U-U MISMATCH, A-C MISMATCH, Zinc finger, NC, Viral protein-RNA COMPLEX
Deposited on 2004-07-30, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Murine leukemia virus [TaxId:11801]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6pa_
  • Chain 'B':
    Compound: 101-mer
    Species: synthetic, synthetic
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u6pA (A:)
    atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll
    

  • Chain 'B':
    No sequence available.