PDB entry 1u6m

View 1u6m on RCSB PDB site
Description: The crystal structure of acetyltransferase
Class: transferase
Keywords: acetyltransferase, GNAT family, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2004-07-30, released 2004-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q836Z8 (3-188)
      • cloning artifact (1-2)
      • expression tag (189)
    Domains in SCOPe 2.06: d1u6ma1, d1u6ma2, d1u6ma3
  • Chain 'B':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q836Z8 (3-188)
      • cloning artifact (1-2)
      • expression tag (189)
    Domains in SCOPe 2.06: d1u6mb1, d1u6mb2, d1u6mb3
  • Chain 'C':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q836Z8 (3-188)
      • cloning artifact (1-2)
      • expression tag (189)
    Domains in SCOPe 2.06: d1u6mc1, d1u6mc2, d1u6mc3
  • Chain 'D':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q836Z8 (3-188)
      • cloning artifact (1-2)
      • expression tag (189)
    Domains in SCOPe 2.06: d1u6md1, d1u6md2, d1u6md3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u6mA (A:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mA (A:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u6mB (B:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mB (B:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u6mC (C:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mC (C:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u6mD (D:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mD (D:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve