PDB entry 1u6l

View 1u6l on RCSB PDB site
Description: Crystal structure of protein PA1353 from Pseudomonas aeruginosa
Class: unknown function
Keywords: hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, unknown function
Deposited on 2004-07-30, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3Z1 (3-End)
      • cloning artifact (1-2)
      • modified residue (32)
      • modified residue (53)
      • modified residue (65)
      • modified residue (108)
      • modified residue (121)
      • modified residue (131)
    Domains in SCOPe 2.07: d1u6la1, d1u6la2
  • Chain 'B':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3Z1 (3-End)
      • cloning artifact (1-2)
      • modified residue (32)
      • modified residue (53)
      • modified residue (65)
      • modified residue (108)
      • modified residue (121)
      • modified residue (131)
    Domains in SCOPe 2.07: d1u6lb1, d1u6lb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u6lA (A:)
    mslqivpylifngncreafscyhqhlggtleamlpfgdspecgdipadwkdkimharlvv
    gsfalmasdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasf
    gmftdrfgvawmvnceqdreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6lA (A:)
    slqivpylifngncreafscyhqhlggtleamlpfgdspepadwkdkimharlvvgsfal
    masdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmftd
    rfgvawmvnceqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u6lB (B:)
    mslqivpylifngncreafscyhqhlggtleamlpfgdspecgdipadwkdkimharlvv
    gsfalmasdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasf
    gmftdrfgvawmvnceqdreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6lB (B:)
    slqivpylifngncreafscyhqhlggtleamlpfgdspepadwkdkimharlvvgsfal
    masdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmftd
    rfgvawmvnceqd