PDB entry 1u6k

View 1u6k on RCSB PDB site
Description: TLS refinement of the structure of Se-methionine labelled Coenzyme f420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) from Methanopyrus kandleri
Class: oxidoreductase
Keywords: monomer: alpha/beta domain, helix bundle; trimer of dimers, oxidoreductase
Deposited on 2004-07-30, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.178
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94951 (1-282)
      • modified residue (17-19)
      • modified residue (21)
      • modified residue (43)
      • modified residue (54)
      • modified residue (85)
      • modified residue (108)
      • modified residue (123)
      • modified residue (136)
      • modified residue (144)
      • modified residue (199)
      • modified residue (203)
      • modified residue (239-240)
      • modified residue (278)
    Domains in SCOPe 2.07: d1u6ka_
  • Chain 'B':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94951 (1-282)
      • modified residue (17-19)
      • modified residue (21)
      • modified residue (43)
      • modified residue (54)
      • modified residue (85)
      • modified residue (108)
      • modified residue (123)
      • modified residue (136)
      • modified residue (144)
      • modified residue (199)
      • modified residue (203)
      • modified residue (239-240)
      • modified residue (278)
    Domains in SCOPe 2.07: d1u6kb_
  • Chain 'C':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94951 (1-282)
      • modified residue (17-19)
      • modified residue (21)
      • modified residue (43)
      • modified residue (54)
      • modified residue (85)
      • modified residue (108)
      • modified residue (123)
      • modified residue (136)
      • modified residue (144)
      • modified residue (199)
      • modified residue (203)
      • modified residue (239-240)
      • modified residue (278)
    Domains in SCOPe 2.07: d1u6kc_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u6kA (A:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6kA (A:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u6kB (B:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6kB (B:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u6kC (C:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6kC (C:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe