PDB entry 1u6j

View 1u6j on RCSB PDB site
Description: The Structure of native coenzyme F420-dependent methylenetetrahydromethanopterin dehydrogenase at 2.4A resolution
Class: oxidoreductase
Keywords: monomer: alpha/beta domain, helix bundle; trimer of dimers, oxidoreductase
Deposited on 2004-07-30, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6ja_
  • Chain 'B':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jb_
  • Chain 'C':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jc_
  • Chain 'D':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jd_
  • Chain 'E':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6je_
  • Chain 'F':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jf_
  • Chain 'G':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jg_
  • Chain 'H':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jh_
  • Chain 'I':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6ji_
  • Chain 'J':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jj_
  • Chain 'K':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jk_
  • Chain 'L':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u6jl_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u6jA (A:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jA (A:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u6jB (B:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jB (B:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u6jC (C:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jC (C:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u6jD (D:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jD (D:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u6jE (E:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jE (E:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u6jF (F:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jF (F:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1u6jG (G:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jG (G:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1u6jH (H:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jH (H:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1u6jI (I:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jI (I:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1u6jJ (J:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jJ (J:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1u6jK (K:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jK (K:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1u6jL (L:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6jL (L:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe