PDB entry 1u6d

View 1u6d on RCSB PDB site
Description: Crystal structure of the Kelch domain of human Keap1
Class: protein binding
Keywords: beta-propeller, kelch repeat motif
Deposited on 2004-07-29, released 2004-10-12
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.149
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Kelch-like ECH-associated protein 1
    Species: HOMO SAPIENS
    Gene: Keap1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u6dx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1u6dX (X:)
    gsshhhhhhssglvprgshapkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvp
    rsglagcvvggllyavggrnnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvi
    dghiyavggshgcihhnsveryeperdewhlvapmltrrigvgvavlnrllyavggfdgt
    nrlnsaecyypernewrmitamntirsgagvcvlhnciyaaggydgqdqlnsverydvet
    etwtfvapmkhrrsalgitvhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgr
    sgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6dX (X:)
    pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
    nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
    ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
    amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
    hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt