PDB entry 1u6b

View 1u6b on RCSB PDB site
Description: crystal structure of a self-splicing group I intron with both exons
Class: structural protein/RNA
Keywords: intron, exon, ribozyme, group I, u1a, RNA, structural protein-RNA complex
Deposited on 2004-07-29, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.247
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (Start-97)
    • engineered (30)
    • engineered (35)
  Domains in SCOPe 2.08: d1u6ba_
• Chain 'B':
  Compound: 197-mer
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: 5'-r(*ap*ap*gp*cp*cp*ap*cp*ap*cp*ap*ap*ap*cp*cp*ap*gp*ap*cp*gp *gp*cp*c)-3'
  
• Chain 'D':
  Compound: 5'-r(*cp*ap*(5mu))-3'
  
• Heterogens: K, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1u6bA (A:)
  mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
  evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1u6bA (A:)
  petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
  satnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.