PDB entry 1u69

View 1u69 on RCSB PDB site
Description: Crystal Structure of PA2721 Protein of Unknown Function from Pseudomonas aeruginosa PAO1
Class: structural genomics, unknown function
Keywords: structural genomics, MSCG, Pseudomonas aeruginosa PAO1, hypothetical protein, protein structure initiative (PSI), Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-07-29, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2721
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I0C1
      • modified residue (58)
      • modified residue (143-144)
      • modified residue (146)
    Domains in SCOPe 2.07: d1u69a_
  • Chain 'B':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2721
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I0C1
      • modified residue (58)
      • modified residue (143-144)
      • modified residue (146)
    Domains in SCOPe 2.07: d1u69b_
  • Chain 'C':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2721
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I0C1
      • modified residue (58)
      • modified residue (143-144)
      • modified residue (146)
    Domains in SCOPe 2.07: d1u69c_
  • Chain 'D':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2721
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I0C1
      • modified residue (58)
      • modified residue (143-144)
      • modified residue (146)
    Domains in SCOPe 2.07: d1u69d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u69A (A:)
    ghmnsknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmg
    ipclglnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqi
    tprvlseaiaspdraaarrafeammtmgridiatiekafkggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u69A (A:)
    sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl
    glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv
    lseaiaspdraaarrafeammtmgridiatiekafk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u69B (B:)
    ghmnsknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmg
    ipclglnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqi
    tprvlseaiaspdraaarrafeammtmgridiatiekafkggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u69B (B:)
    sknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipcl
    glnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprv
    lseaiaspdraaarrafeammtmgridiatiekafk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u69C (C:)
    ghmnsknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmg
    ipclglnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqi
    tprvlseaiaspdraaarrafeammtmgridiatiekafkggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u69C (C:)
    sknticlwydsaaleaatfyaetfpdsavlavhrapgdvltvefrvmgipclglnggpaf
    rhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprvlseaiasp
    draaarrafeammtmgridiatiekafk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u69D (D:)
    ghmnsknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmg
    ipclglnggpafrhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqi
    tprvlseaiaspdraaarrafeammtmgridiatiekafkggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u69D (D:)
    sknticlwydsaaleaatfyaetfpdsavlavhrapdvltvefrvmgipclglnggpafr
    hseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprvlseaiaspd
    raaarrafeammtmgridiatiekafk