PDB entry 1u68

View 1u68 on RCSB PDB site
Description: dhna 7,8 dihydroneopterin complex
Class: lyase
Keywords: dhna, 7,8 dihydroneopterin, lyase
Deposited on 2004-07-29, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.279
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroneopterin aldolase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u68a_
  • Heterogens: NPR

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u68A (A:)
    mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
    vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
    k