PDB entry 1u67

View 1u67 on RCSB PDB site
Description: crystal structure of arachidonic acid bound to a mutant of prostagladin h synthase-1 that forms predominantly 11-hpete.
Deposited on 2004-07-29, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.238
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u67A (A:)
    msrqsislrfpllllllspspvfsadpgapapvnpccyypcqhqgicvrfgldryqcdct
    rtgysgpnctipeiwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvr
    snlipspptyniahdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrr
    fllrrkfipdpqgtnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnler
    qyqlrlfkdgklkyqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglml
    yatiwlrehnrvcdllkaehptwgdeqlfqtarliligetikivieeyaqqlsgyflqlk
    fdpellfgaqfqyrnriamefnqlyhfhplmpdsfrvgpqdysyeqflfntsmlvdygve
    alvdafsrqpagrigggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqe
    ltgekemaaeleelygdidalefypglllekchpnsifgesmiemgapfslkgllgnpic
    speywkastfggevgfnlvktatlkklvclntktcpyvsfhvpdprqedrpgverpptel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u67A (A:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyaqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhfhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd