PDB entry 1u67

View 1u67 on RCSB PDB site
Description: Crystal Structure of Arachidonic Acid Bound to a Mutant of Prostagladin H Synthase-1 that Forms Predominantly 11-HPETE.
Class: oxidoreductase
Keywords: cyclooxgenase, arachidonic acid, heme, eicosanoid, 11-HETE, COX-1, COX-2, OXIDOREDUCTASE
Deposited on 2004-07-29, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.238
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin G/H synthase 1 precursor
    Species: Ovis aries [TaxId:9940]
    Gene: PTGS1, COX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05979
      • see remark 999 (91)
      • engineered (348)
      • engineered (386)
    Domains in SCOPe 2.07: d1u67a1, d1u67a2
  • Heterogens: BOG, COH, ACD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u67A (A:)
    msrqsislrfpllllllspspvfsadpgapapvnpccyypcqhqgicvrfgldryqcdct
    rtgysgpnctipeiwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvr
    snlipspptyniahdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrr
    fllrrkfipdpqgtnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnler
    qyqlrlfkdgklkyqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglml
    yatiwlrehnrvcdllkaehptwgdeqlfqtarliligetikivieeyaqqlsgyflqlk
    fdpellfgaqfqyrnriamefnqlyhfhplmpdsfrvgpqdysyeqflfntsmlvdygve
    alvdafsrqpagrigggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqe
    ltgekemaaeleelygdidalefypglllekchpnsifgesmiemgapfslkgllgnpic
    speywkastfggevgfnlvktatlkklvclntktcpyvsfhvpdprqedrpgverpptel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u67A (A:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyaqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhfhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd