PDB entry 1u63

View 1u63 on RCSB PDB site
Description: THE STRUCTURE OF A RIBOSOMAL PROTEIN L1-mRNA COMPLEX
Class: transcription/RNA
Keywords: ribosome, ribosomal protein, mRNA-protein complex, transcription-RNA complex
Deposited on 2004-07-29, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1p
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: rpl1p
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54050 (0-End)
      • modified residue (36)
      • modified residue (111)
      • modified residue (118)
      • modified residue (128)
      • modified residue (168)
      • modified residue (204)
    Domains in SCOPe 2.07: d1u63a1
  • Chain 'B':
    Compound: 49 nt fragment of mRNA for l1
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 50s ribosomal protein l1p
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: rpl1p
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54050 (0-End)
      • modified residue (36)
      • modified residue (111)
      • modified residue (118)
      • modified residue (128)
      • modified residue (168)
      • modified residue (204)
    Domains in SCOPe 2.07: d1u63c1
  • Chain 'D':
    Compound: 49 nt fragment of mRNA for l1
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u63A (A:)
    mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
    avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
    vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
    vlnvvakkyekglyhikdayvkltmgpavkvkkekakkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u63A (A:)
    mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
    avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
    vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
    vlnvvakkyekglyhikdayvkltmgpavkvkke
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u63C (C:)
    mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
    avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
    vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
    vlnvvakkyekglyhikdayvkltmgpavkvkkekakkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u63C (C:)
    mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
    avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
    vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
    vlnvvakkyekglyhikdayvkltmgpavkvkke
    

  • Chain 'D':
    No sequence available.